PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.185900.1
Common NameCsa_6G426360, LOC101220747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 699aa    MW: 76365.7 Da    PI: 7.6029
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.185900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.4e-094124491954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Cucsa.185900.1 412 FEHflHPYPKDSDKIILAKQTGLTRSQVSNWFINARVR 449
                     554459******************************88 PP

2BELL110.87.9e-36267338172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rq+lq+kkakL+ +l+eV+++Ykqy++q++ v+s Fe++aglgsak+Y+slAl +iS++FrcLkdai++qi
  Cucsa.185900.1 267 QRQDLQMKKAKLIGMLDEVEQKYKQYHQQIRGVVSCFEQAAGLGSAKSYASLALETISKQFRCLKDAICGQI 338
                     699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-60189336IPR006563POX domain
PfamPF075265.1E-45194334IPR006563POX domain
PROSITE profilePS5007111.888390453IPR001356Homeobox domain
SMARTSM003892.2E-9393457IPR001356Homeobox domain
CDDcd000865.37E-12393454No hitNo description
SuperFamilySSF466899.84E-17394459IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28396459IPR009057Homeodomain-like
PfamPF059201.4E-17410449IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MATYFHGGSE IQNNSDGIHT LYLMNPNYVP YSDTHSQSSH NMLFLNPSST HALNPSTLPH  60
PPPSNNHFVG IPLPTTDPLR PSYHEISTTL HPHRLHYNLW APVDQQHQHH QQPLHADSAD  120
LTFRRPTAQQ SLSLSLSSQQ SLYRTLSAEQ EIQGGGGGGG GGGGAPSGEE IRVSGNSGTS  180
VSVVSSGITG VQSVILGSKY LKAAQELLDE VVHVGKANFK TDKFGDGTKD KMKMKRESTT  240
TIGGGSSATT GGGETTSKSV AELSTAQRQD LQMKKAKLIG MLDEVEQKYK QYHQQIRGVV  300
SCFEQAAGLG SAKSYASLAL ETISKQFRCL KDAICGQIKA TGKSLGEDQE NWLGSSKMEG  360
SSTTSSSRLR YVDHHLRQQR ALQQLGMIQH NTWRPQRGLP ERAVSVLRAW LFEHFLHPYP  420
KDSDKIILAK QTGLTRSQVS NWFINARVRL WKPMVEEMYL EEIKEQEQNG DSQDMIRGGG  480
SQHQNNNNNN RTHNDPQYSK TENLMNNNPS HSSISSSSIL GIGSTTVGGG FSLVPPSSDN  540
NILLSTPKKP RTTTTTAAIT TTNNNNNVVS ENPSSESMLL RDIDIVNSNS FPVGEIGSTF  600
NSELLTPRFH ANGVSLTLAL PHNNSDHLSL SPNQTNYHHL SSNQNLHLGR SSRLDITNHH  660
PGPPDFSDVN PTAPPSYDHV DMQTTKRFAA QLLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B7e-16399457563Homeobox protein Meis2
3k2a_A7e-16399457563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818420.0LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657593.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0A0KEF70.0A0A0A0KEF7_CUCSA; Uncharacterized protein
STRINGVIT_06s0009g00410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-89BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]